PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008234392.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 321aa    MW: 37125.3 Da    PI: 6.5629
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008234392.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1813.1e-5671361129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeelv++yL+kkv++++++l +vik+vd+yk+ePwdL++  ++ + e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk++
  XP_008234392.1   7 VPPGFRFHPTDEELVDYYLRKKVSSRRIDL-DVIKDVDLYKIEPWDLQElcRIGTeEQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAI 100
                     69****************************.9***************954555442556************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +s k+ l+g++ktLvfykgrap+g+k+dW+mheyrle
  XP_008234392.1 101 YS-KHDLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                     **.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-615157IPR003441NAC domain
PROSITE profilePS5100560.3597157IPR003441NAC domain
PfamPF023656.4E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MNTFSHVPPG FRFHPTDEEL VDYYLRKKVS SRRIDLDVIK DVDLYKIEPW DLQELCRIGT  60
EEQNEWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAI YSKHDLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETDEN GTPQQEEGWV VCRVFKKKIA SLRIKMNEHE SPCWYDDQVS  180
FMPDLDSPNQ NSNSNINMAP YHHLPYPCKK ELDHLPAFQF PHEHFFQLPF LGSPKLLQSS  240
ATGVSSSNSM AAHAYSIDIN HACTFQPSDQ DQNFHGAVYG NNSNDDHPQA VDQLTDWRML  300
DKFVASQLSQ DDASNKGNSY S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-50615814169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008234392.10.0PREDICTED: NAC domain-containing protein 7-like isoform X1
SwissprotQ9FWX21e-131NAC7_ARATH; NAC domain-containing protein 7
TrEMBLM5X7780.0M5X778_PRUPE; Uncharacterized protein
STRINGVIT_16s0022g00690.t011e-173(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-122NAC 007